PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G013700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family SRS
Protein Properties Length: 354aa    MW: 38366.6 Da    PI: 8.3068
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G013700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702207.24.5e-641522933154
              DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklss 93 
                         s +++CqdCGnqakkdC+h RCRtCCk+rgf C+thvkstWvpaakrrerqqql+a+++ ++  + e+ +kr++++         ++ +s 
  Phvul.009G013700.1 152 SSGINCQDCGNQAKKDCTHLRCRTCCKTRGFPCQTHVKSTWVPAAKRRERQQQLSALQNPQQ-FRGENIPKRHHRD---------TQLVSA 232
                         5678**************************************************99866554.4455555555543.........333445 PP

              DUF702  94 aeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                          ++   l+  ++P+evs++avfrcvrvs+vd ++e++aYqt+vsigGhvfkGiLydqG+e+
  Phvul.009G013700.1 233 PQPIAGLQLGQFPPEVSTSAVFRCVRVSAVDASDEQCAYQTSVSIGGHVFKGILYDQGPES 293
                         5666789999*************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.5E-61154292IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.3E-25156198IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.2E-24243291IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGKIASETLK IREKKILIYG DETTHPHHIT VQHSQLDMAR HHGNKASLNS SCAAARGGPQ  60
NKEEGEVGKG DSNNNNNGNN LLLFRNEEIY NKGFEIWPES YQPQAAPQNL SNYFAFGVGP  120
SRRNCSEEVS LCVSDESTRF GLTVMRSGGA GSSGINCQDC GNQAKKDCTH LRCRTCCKTR  180
GFPCQTHVKS TWVPAAKRRE RQQQLSALQN PQQFRGENIP KRHHRDTQLV SAPQPIAGLQ  240
LGQFPPEVST SAVFRCVRVS AVDASDEQCA YQTSVSIGGH VFKGILYDQG PESSYTSAAT  300
EGSSGGDPRQ LGLITGAATA TTTSGNHPFD PSLYPAPLNA FMSGTQFFHP PRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136048.10.0hypothetical protein PHAVU_009G0137001g, partial
SwissprotQ9LQZ53e-74SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLV7AQV40.0V7AQV4_PHAVU; Uncharacterized protein (Fragment)
STRINGGLYMA04G03000.11e-149(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.12e-65SHI-related sequence 5